PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00028977-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family MYB_related
Protein Properties Length: 114aa    MW: 12825.3 Da    PI: 4.452
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00028977-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding33.78.2e-1163105145
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                         ++ ++++E+ l+++ +++ G + W++Ia +++ gRt++++  +w 
  WALNUT_00028977-RA  63 KLEFSEDEEMLIIRMFNLVGER-WSLIAGRIP-GRTAEEIEKYWT 105
                         678*******************.*********.***********5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.37458112IPR017930Myb domain
SMARTSM007174.2E-962110IPR001005SANT/Myb domain
PfamPF002491.1E-964105IPR001005SANT/Myb domain
SuperFamilySSF466895.55E-965108IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.5E-1365106IPR009057Homeodomain-like
CDDcd001672.25E-965104No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 114 aa     Download sequence    Send to blast
MASPLPSQTK QLPIGFAGFI SFSRNLCLMA DSQNSSSNGV RNETPSNDTF ADSRSEETSE  60
ASKLEFSEDE EMLIIRMFNL VGERWSLIAG RIPGRTAEEI EKYWTSRYST SEMK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010052817.16e-35PREDICTED: MYB-like transcription factor ETC1
TrEMBLA0A059DGB66e-34A0A059DGB6_EUCGR; Uncharacterized protein
STRINGPOPTR_0011s00390.15e-33(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF26923178
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46410.11e-17MYB_related family protein